PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00377.50
Common NameJCGZ_04507, LOC105633875
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family MIKC_MADS
Protein Properties Length: 224aa    MW: 25896.5 Da    PI: 9.1249
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00377.50genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.45.2e-30959151
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                   krien++nrqvt+skRrng++KKA+EL vLCda+v++i+fsstgkl+ey+s
  Jcr4S00377.50  9 KRIENSTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYIS 59
                   79***********************************************86 PP

2K-box80.54.1e-2771172199
          K-box   1 yqkssgksleeakae...slqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                    yqk+ g +l++++++   s+q++l+kLk+ ++nL +e+R+++Ge+L++ s+++L++Leq+++++l  +R++Kn+++ +qi++ +kk ++++e++++
  Jcr4S00377.50  71 YQKTLGIDLWSTQYAvciSMQENLKKLKDVNRNLITEIRQRMGECLNDASFEHLRSLEQDVDTALLLVRQRKNKMINNQIQTCRKKVRNVEEIHQN 166
                    67777778888887655589**************************************************************************** PP

          K-box  94 Lrkkle 99 
                    L +++e
  Jcr4S00377.50 167 LLREFE 172
                    **9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.1E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.45161IPR002100Transcription factor, MADS-box
CDDcd002656.59E-41280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-29323IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.71E-35392IPR002100Transcription factor, MADS-box
PfamPF003191.1E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-293859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129714.41287177IPR002487Transcription factor, K-box
PfamPF014861.1E-1889171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MARGKIQIKR IENSTNRQVT YSKRRNGLFK KANELTVLCD AKVSIIMFSS TGKLHEYISP  60
STTTKQLFDE YQKTLGIDLW STQYAVCISM QENLKKLKDV NRNLITEIRQ RMGECLNDAS  120
FEHLRSLEQD VDTALLLVRQ RKNKMINNQI QTCRKKVRNV EEIHQNLLRE FEARDEDPHY  180
GLVDNGAGDY DSMLRNIFAL RLQPNHPNLQ SGAGSDLTTY TLLD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D4e-15260159Myocyte-specific enhancer factor 2A
3mu6_C4e-15260159Myocyte-specific enhancer factor 2A
3mu6_B4e-15260159Myocyte-specific enhancer factor 2A
3mu6_A4e-15260159Myocyte-specific enhancer factor 2A
1egw_D5e-15259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C5e-15259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B5e-15259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A5e-15259158MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_S5e-15159159Myocyte-specific enhancer factor 2B
1tqe_R5e-15159159Myocyte-specific enhancer factor 2B
1tqe_Q5e-15159159Myocyte-specific enhancer factor 2B
1tqe_P5e-15159159Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00077ChIP-seqTransfer from AT3G54340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012071964.11e-163PREDICTED: floral homeotic protein DEFICIENS-like isoform X2
SwissprotP237061e-108DEFA_ANTMA; Floral homeotic protein DEFICIENS
TrEMBLA0A067KR091e-163A0A067KR09_JATCU; Uncharacterized protein
STRINGVIT_18s0001g13460.t011e-111(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27353375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.15e-90MIKC_MADS family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]